PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G52250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 1656aa    MW: 181750 Da    PI: 7.0652
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G52250.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.22.9e-11867908346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT eE e+++++ +++G++ +k+Ia+ +   +t  +c+++++k
      AT3G52250.1 867 PWTSEEKEIFLNLLAMHGKD-FKKIASSLT-QKTTADCIDYYYK 908
                      8*****************99.********9.9**********98 PP

2Myb_DNA-binding28.92.6e-0910901131447
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding    4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                       WT +E   +++++ ++G++ +++I+r++g +R++ qck ++ k+
      AT3G52250.1 1090 WTDDERSAFIQGFSLFGKN-FASISRYVG-TRSPDQCKVFFSKV 1131
                       *****************99.*********.********998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.54E-14850911IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-7859910IPR009057Homeodomain-like
PROSITE profilePS5129314.899863914IPR017884SANT domain
SMARTSM007171.9E-9864912IPR001005SANT/Myb domain
PfamPF002493.1E-9866908IPR001005SANT/Myb domain
CDDcd001677.86E-8867909No hitNo description
PROSITE profilePS5129313.03910851136IPR017884SANT domain
SMARTSM007174.0E-810861134IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-510891130IPR009057Homeodomain-like
SuperFamilySSF466891.01E-910891136IPR009057Homeodomain-like
CDDcd001675.06E-710901131No hitNo description
PfamPF002491.4E-710901130IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008380Biological ProcessRNA splicing
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 1656 aa     Download sequence    Send to blast
MPQDHASWDR KELLRQRKHD RPEQSFESPP FRWRDSPSSH HVPREFSSRL GSGDFRRPSC  60
HGKQGGRHQF VEETSHGYTS SRSSARMFDN YRPSASRGDW RYTRNCRDDR VSVSQKEWKC  120
NTWEMSNGSS RSFERPFGIR NGRRSVDERP LHASDTHSTV VNSLDPANSA HYLDNEISTP  180
VRSLKIKNEH KFSDQRLSLP SDPHSECISL FERPSSENNY GNKVCSPAKQ CNDLMYGRRL  240
VSDNSLDAPI PNAELEGTWE QLRLKDPQDN NSLHGINDID GDRKCAKESS LGATGKLPLW  300
NSSGSFASQS SGFSHSSSLK SLGAVDSSDR KIEVLPKIVT VTQSSSGDAT ACATTTHLSE  360
EMSSRKKQRL GWGEGLAKYE KKKVDVNPNE DGTTLMENGL EELHSLNKNI ADKSPTAAIV  420
PDYGSPTTPS SVACSSSPGF ADKSSPKAAI AASDVSNMCR SPSPVSSIHL ERFPINIEEL  480
DNISMERFGC LLNELLGTDD SGTGDSSSVQ LTSMNTLLAW KGEILKAVEM TESEIDLLEN  540
KHRTLKLEGR RHSRVVGPSS YCCDGDANVP KEQASCSLDP KATASSVAKT LVRAPVHQAG  600
LAKVPADVFE DSPGEVKPLS QSFATVEREE DILPIPSMKA AVSSKEINTP AFANQETIEV  660
SSADDSMASK EDLFWAKLLS ANKKYACESS GVFNQLLPRD FNSSDNSRFP GICQTQFDSH  720
VQEKIADRVG LLRAREKILL LQFKAFQLSW KKDLDQLALA KYQSKSSKKT ELYPNAKNGG  780
YLKLPQSVRL RFSSSAPRRD SVVPTTELVS YMEKLLPGTH LKPFRDILKM PAMILDEKER  840
VMSRFISSNG LIEDPCDVEK ERTMINPWTS EEKEIFLNLL AMHGKDFKKI ASSLTQKTTA  900
DCIDYYYKNH KSDCFGKIKK QRAYGKEGKH TYMLAPRKKW KREMGAASLD ILGDVSIIAA  960
NAGKVASTRP ISSKKITLRG CSSANSLQHD GNNSEGCSYS FDFPRKRTAG ADVLAVGPLS  1020
PEQINSCLRT SVSSRERCMD HLKFNHVVKK PRISHTLHNE NSNTLHNENS NEEDDSCSEE  1080
SCGETGPIHW TDDERSAFIQ GFSLFGKNFA SISRYVGTRS PDQCKVFFSK VRKCLGLESI  1140
KFGSGNVSTS VSVDNGNEGG GSDLEDPCPM ESNSGIVNNG VCAKMGMNSP TSPFNMNQDG  1200
VNQSGSANVK ADLSRSEEEN GQKYLCLKDD NNLVNNAYVN GGFPSLVSES CRDLVDINTV  1260
ESQSQAAGKS KSNDLMSMEI DEGVLTSVTI SSEPLYCGLS VLSNVIVETP TEISRKGSGD  1320
QGATMPKFSS KNQDGVMQAA NRTRNSGLEP ESAPSGFRYP ECLHHVPIEV CTENPIGVSA  1380
PRGNPNCHAE SESGNSLVGQ VDETHDLGWP KNNLELDGRL QVLGHVNPEQ IGLLKATNTE  1440
SCQNPQRSVT QDLSRISRSK SDLIVKTQRT GEGFSLTKCT SSAPKPLAVS HKEGRSGHSR  1500
SHSFSLSDTE RLHKNGDVKL FGTVLTTDEN GIKQKHNPCG IVRSSSTLSR DHDTRHHYIN  1560
QQHLQNVPIT SYGFWDGNRI QTGLTSLPES AKLLASCPEA FSTHLKQQVG NSKEILVDVN  1620
GGILSFGKHN EDRAESSSAK DEGNIGGVNG VAEAAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C4e-15825915493NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D4e-15825915493NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865109600.0
Expression AtlasAT3G52250-
AtGenExpressAT3G52250-
Functional Description ? help Back to Top
Source Description
TAIREncodes a protein with a putative role in mRNA splicing.
Function -- GeneRIF ? help Back to Top
  1. PWR(POWERDRESS) promotes floral determinacy by enhancing the expression of three of the five MIR172 members as well as CRC.
    [PMID: 23349639]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G52250.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G52250
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1329720.0AL132972.1 Arabidopsis thaliana DNA chromosome 3, BAC clone T25B15.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_190793.20.0protein POWERDRESS
TrEMBLF4J6V10.0F4J6V1_ARATH; Duplicated homeodomain-like superfamily protein
STRINGAT3G52250.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Representative plantOGRP32151725
Publications ? help Back to Top
  1. Yumul RE, et al.
    POWERDRESS and diversified expression of the MIR172 gene family bolster the floral stem cell network.
    PLoS Genet., 2013. 9(1): p. e1003218
    [PMID:23349639]